DPCfam | MC225209
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 125 ± 12 aa |
| Residues in low-complexity regions (%) | 1.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09172 |
| Sequences matching dominant architecture (%) | 97.14 |
| Average overlap percent | 44.96 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8JIF8 | 715-841 | 127 | LKKWETLPDDKPLLSVYTRASGQEFFFNDFNKDFMERMMREFSPTAGRDSFVWRMIEQLIHGFSWRGVLPFLTVEARYIQATTLG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q90243-F1 | 699-830 | 100.00 | 76.52 | View in AlphaFoldDB ↗ |