DPCfam | MC22485
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Residues in low-complexity regions (%) | 8.43 |
| Residues in coiled-coil regions (%) | 43.73 |
| Predicted disordered residues (%) | 40.33 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17871 |
| Sequences matching dominant architecture (%) | 0.71 |
| Average overlap percent | 3.01 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J5Q0P8 | 382-464 | 83 | WEKEKAEIESLKRTKEELERARFELDRAQREGNFAKAGELRYSTIPSLEAKLPKEGEEAAAGGTTLIHDSVTPDDIANVVSRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7NFE9-F1 | 461-548 | 100.00 | 85.86 | View in AlphaFoldDB ↗ |