DPCfam | MC224776
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Residues in low-complexity regions (%) | 1.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.04 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10108 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 39.11 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q2KRI7 | 170-259 | 90 | MADLPGKYDVHGDEVMKLYYEDKIEKIHEYCESDVLNTYMLFLKYELIKGNVSDEDYAYFLNSMSEFLKAKKANRAYVEIFCKAC... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5FA73-F1 | 188-264 | 100.00 | 95.38 | View in AlphaFoldDB ↗ |