DPCfam | MC224675
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 215 ± 30 aa |
| Residues in low-complexity regions (%) | 5.21 |
| Residues in coiled-coil regions (%) | 14.44 |
| Predicted disordered residues (%) | 25.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16969 |
| Sequences matching dominant architecture (%) | 95.19 |
| Average overlap percent | 41.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A095C6Z3 | 537-812 | 276 | LLYTYLQYLKLSKTIDRTLLHIETTISSLAQGSHKRNQLATSAYPKPQELSRLYDTLVQNFQEIISLPCLVQDHVGLKDLLYAKM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8BMA6-F1 | 409-619 | 96.68 | 80.49 | View in AlphaFoldDB ↗ |