DPCfam | MC224652
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 137 ± 61 aa |
| Residues in low-complexity regions (%) | 3.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 47.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15433 |
| Sequences matching dominant architecture (%) | 91.04 |
| Average overlap percent | 50.97 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0007DC96E3 | 191-383 | 193 | LDPKVVSAASAAAATLPNSNQALNELLKQLKENELVTEGQKRGNVNNLRYVDTQCAHVHISGVRKYPYTVITQHLLCSSRKIGTD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VUX1-F1 | 97-292 | 99.45 | 71.41 | View in AlphaFoldDB ↗ |