DPCfam | MC224636
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 160 ± 17 aa |
| Residues in low-complexity regions (%) | 3.32 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 11.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G4MHM3 | 7-191 | 185 | VLVTNTLTPHDISVLVLVAFYCGNVERVSPSLISTMIPPLTSDSQDAAMYAISKNSNPPLPVLPTLEELIQRLFEKNHSQAGIKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5ZKK3-F1 | 26-164 | 99.35 | 84.36 | View in AlphaFoldDB ↗ |