DPCfam | MC22460
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Residues in low-complexity regions (%) | 1.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.22 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10029 |
| Sequences matching dominant architecture (%) | 94.51 |
| Average overlap percent | 88.27 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F4B2Y1 | 14-169 | 156 | LAFILVTFTSASTVSAIAEENETTAVKCMIQMTNYSGEGAYIVISLINPKGEYEQTLHVQGKDTEWYSEIKEWWQFYGKQDDGID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0A1I9-F1 | 158-201 | 33.09 | 96.74 | View in AlphaFoldDB ↗ |