DPCfam | MC224280
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Residues in low-complexity regions (%) | 9.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.98 |
| Average transmembrane regions | 1.88 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U2Z988 | 1-94 | 94 | MPNCKNCGTKWSWGDAFKVSFLNKRICPKCEEMQYLKSHTNAKKFYAAGAFLFIVNIIRPYLDIPLNLFTLIFTLYVCALFIVLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O43345-F1 | 722-762 | 40.00 | 74.74 | View in AlphaFoldDB ↗ |