DPCfam | MC224181
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 140 ± 17 aa |
| Residues in low-complexity regions (%) | 2.24 |
| Residues in coiled-coil regions (%) | 0.84 |
| Predicted disordered residues (%) | 28.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18119- PF00271 |
| Sequences matching dominant architecture (%) | 88.14 |
| Average overlap percent | 54.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000947E2BE | 611-765 | 155 | HLRKYTDALAINADARTKDALQYLDKFVAGLQREGFDGTDRDLVKHFTGRQDRHVCLNESFDVDLYYRWQRQRGRLETYAADEKY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9BYX4-F1 | 600-773 | 100.00 | 81.99 | View in AlphaFoldDB ↗ |