DPCfam | MC224160
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 82 ± 8 aa |
| Residues in low-complexity regions (%) | 4.21 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.39 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF10996 |
| Sequences matching dominant architecture (%) | 30.53 |
| Average overlap percent | 39.22 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000626CD83 | 232-316 | 85 | TVAMTLRAGGCVLIPCYPSGVVYDLFECLSTHLDKSGFLQVPLFFISPVAESSLAYSNILAEWLSTSKQKKVYLPEEPFPHAFLV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7SBF0-F1 | 292-369 | 97.50 | 94.18 | View in AlphaFoldDB ↗ |