DPCfam | MC224048
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 137 ± 15 aa |
| Residues in low-complexity regions (%) | 1.28 |
| Residues in coiled-coil regions (%) | 13.25 |
| Predicted disordered residues (%) | 17.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A017RTF9 | 356-481 | 126 | LVGLSEILEENVNNELKKKSEINGMVEKLADKVCASCESRGQCWKKELYCTYESFIELLRNAERIGRVGINEMPEDMRRKCLRPN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P49600-F1 | 115-259 | 99.31 | 80.49 | View in AlphaFoldDB ↗ |