DPCfam | MC223940
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 151 ± 16 aa |
| Residues in low-complexity regions (%) | 9.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03343 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 30.8 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G6D198 | 471-623 | 153 | LEEILQQIKEEKTEESQEAGGSMVLDATAEFCRTLGDIPTYGLAGNREHTAEIMDFDREEAEPEPESGASGGAWSRVDVRTDRPA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q95TU2-F1 | 701-842 | 88.31 | 54.31 | View in AlphaFoldDB ↗ |