DPCfam | MC223771
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 203 ± 42 aa |
| Residues in low-complexity regions (%) | 1.18 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.81 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF03175 |
| Sequences matching dominant architecture (%) | 91.21 |
| Average overlap percent | 52.57 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P1AWU1 | 63-264 | 202 | FPKTEINIAKRFPEVAGGHLNGDHIAYCAAWKIGNNATQKAWGLNCVRDMLDSLPADQNFLMWAHNAGFDERVLIWYLSTFDNRG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O62074-F1 | 614-889 | 97.78 | 81.90 | View in AlphaFoldDB ↗ |