DPCfam | MC223634
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 461 |
|---|---|
| Mean domain length (aa) | 419 ± 50 aa |
| Residues in low-complexity regions (%) | 3.65 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.62 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF12937 |
| Sequences matching dominant architecture (%) | 10.94 |
| Average overlap percent | 9.39 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F2MCQ4 | 2-542 | 541 | ASWQRLPTEIKLAIWGSVAKDAEDDRRTRKLQLDKNQKPVSLAPFAAVALDWQSFFEQVTFRRLFIEDDQVDRFAALVKGPRKKQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PT31-F1 | 7-475 | 94.13 | 81.09 | View in AlphaFoldDB ↗ |