DPCfam | MC223452
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Residues in low-complexity regions (%) | 1.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01966 |
| Sequences matching dominant architecture (%) | 83.91 |
| Average overlap percent | 33.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009F9ED6A | 138-200 | 63 | VMEQLDFPEEKREAVAYAIANHSFSKGVVPSTMEGKVLQDADRLDAIGAIGMARLFSTCASME... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32HJ6-F1 | 3-64 | 96.88 | 94.75 | View in AlphaFoldDB ↗ |