DPCfam | MC223292
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 147 ± 20 aa |
| Residues in low-complexity regions (%) | 4.12 |
| Residues in coiled-coil regions (%) | 0.78 |
| Predicted disordered residues (%) | 23.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03813 |
| Sequences matching dominant architecture (%) | 96.59 |
| Average overlap percent | 12.81 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006C9B28D | 28-162 | 135 | EELSQLREQISLENVFHSNLIRLQVEETLKNVEIKQKYKKLFKLWLQKFTEQVNAIDDDVEYELNDNTLCDNVQVPMDVLKNYCP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6NRY2-F1 | 64-214 | 99.35 | 90.21 | View in AlphaFoldDB ↗ |