DPCfam | MC223251
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 126 ± 8 aa |
| Residues in low-complexity regions (%) | 0.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00041 |
| Sequences matching dominant architecture (%) | 0.93 |
| Average overlap percent | 67.2 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008F9F288 | 740-866 | 127 | IWIPFSFRYNPAHSSCKGSQFVKRTWYRKFVGVVLCNSLRYKIFMGDGLKETFYSIADTFGHGEDHCQFVDSYLDGRTGPHNLSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q4ZHG4-F1 | 1766-1891 | 97.76 | 86.28 | View in AlphaFoldDB ↗ |