DPCfam | MC223186
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 106 ± 15 aa |
| Residues in low-complexity regions (%) | 2.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.31 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF18934 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 19.18 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W7SKK4 | 432-547 | 116 | FFDLAASATLGEDDEPDRVAIDPLGLLAEAAGFDDPERWWEDVVEHHAAADPIGLAQAVAEAMTALRDEFADHVGQRTLRREAAM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F5V5-F1 | 120-266 | 99.11 | 73.14 | View in AlphaFoldDB ↗ |