DPCfam | MC223089
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 381 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Residues in low-complexity regions (%) | 0.67 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.89 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF18296 |
| Sequences matching dominant architecture (%) | 73.35 |
| Average overlap percent | 22.87 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H6C9T5 | 841-937 | 97 | LKLPTSQICVRRADQPLFASASIMEFWDTLNLQPESGAKVVTAFCLHPSGGSVAEGCSNFLQRMTDTYNSCALGKHSTGRIPGVT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1LXU0-F1 | 1196-1275 | 98.77 | 91.85 | View in AlphaFoldDB ↗ |