DPCfam | MC222533
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 401 |
|---|---|
| Mean domain length (aa) | 129 ± 27 aa |
| Residues in low-complexity regions (%) | 3.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.53 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF04099 |
| Sequences matching dominant architecture (%) | 90.79 |
| Average overlap percent | 87.95 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q5KJ45 | 5-142 | 138 | ALWIISKAGGLVFSRSYSDALPQLPVNTILTLAGILHGIHAITARLTPSPAASSQNQSQGPGSTGGLESFEAEGWGGKVFLTPTG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GT60-F1 | 44-238 | 99.25 | 76.49 | View in AlphaFoldDB ↗ |