DPCfam | MC222133
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 157 ± 18 aa |
| Residues in low-complexity regions (%) | 20.15 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 58.76 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09444 |
| Sequences matching dominant architecture (%) | 99.09 |
| Average overlap percent | 87.9 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C3CAR7 | 1009-1188 | 180 | NAFEALARGATKAEKRRPDKAKSAELSVFVENEAAESDDEDVFGFAKPKDDDEEEGEDLDKPLDVLMDDKEMDEATVAAELVHEK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VX56-F1 | 929-1083 | 97.53 | 77.14 | View in AlphaFoldDB ↗ |