DPCfam | MC222132
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 169 ± 15 aa |
| Residues in low-complexity regions (%) | 9.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.98 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A078ADD5 | 224-396 | 173 | LLSKDLNSILLNLINRKRFKYTALNILEYVFSCLCLKRGTSLKYKQKFKKHFIFKKGQDKLLEELDIVSILKSMRQVKLLTQVLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O00844-F1 | 402-535 | 81.76 | 72.89 | View in AlphaFoldDB ↗ |