DPCfam | MC221947
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 277 ± 47 aa |
| Residues in low-complexity regions (%) | 5.21 |
| Residues in coiled-coil regions (%) | 10.38 |
| Predicted disordered residues (%) | 27.59 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00849 |
| Sequences matching dominant architecture (%) | 0.8 |
| Average overlap percent | 0.93 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1G9MZR5 | 18-255 | 238 | YCKDCGEIHELPSELAIPHCLELMAQLGEHRRIDFDVALEDADPRLSTDGLYTAMRGRMFGILVCQDAEGKEVILRAFSSRHNGV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q556N4-F1 | 70-127 | 22.22 | 75.17 | View in AlphaFoldDB ↗ |