DPCfam | MC221769
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 204 ± 37 aa |
| Residues in low-complexity regions (%) | 10.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 78.58 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A2A9A62 | 638-813 | 176 | GIHFADDLGPEHDRETSQFIRHDTPRFKDLKARHPKRVIHKTHPGAADGAVRHGRSFTDEESASDSDSVKHKKIAFEENTTEDKP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7KRY7-F1 | 432-658 | 99.52 | 32.44 | View in AlphaFoldDB ↗ |