DPCfam | MC221752
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Residues in low-complexity regions (%) | 0.84 |
| Residues in coiled-coil regions (%) | 0.66 |
| Predicted disordered residues (%) | 9.99 |
| Average transmembrane regions | 0.5 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D6H0M6 | 687-759 | 73 | KTPIFEVLAPSFQIAFSLMSHSLGGTDSLPPSRRRSLFTLATSMIVFASRAFNVAPLLPICKLMLNDGTMDPF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F4IAF6-F1 | 659-724 | 100.00 | 83.74 | View in AlphaFoldDB ↗ |