DPCfam | MC221449
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Residues in low-complexity regions (%) | 5.09 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00036AC778 | 21-86 | 66 | VLEPGRNVWRVAGAARARVLVDGAAYFGALRAAMLEARETIHIAGWDLDSRMKLVGERGTAEDGLP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F090-F1 | 7-59 | 94.64 | 96.19 | View in AlphaFoldDB ↗ |