DPCfam | MC221363
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 82 ± 12 aa |
| Residues in low-complexity regions (%) | 2.76 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10124 |
| Sequences matching dominant architecture (%) | 94.29 |
| Average overlap percent | 49.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S7QSR4 | 215-298 | 84 | FGFWQMAWGSKQVLDTAHYEAARTGLANMKGDYGRPLAIQPKLLVVPPSLEGAARRIVGNSLKDGGGTNEWFGTAEVLVVPWLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P44227-F1 | 223-308 | 98.80 | 94.26 | View in AlphaFoldDB ↗ |