DPCfam | MC220858
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 244 ± 35 aa |
| Residues in low-complexity regions (%) | 3.08 |
| Residues in coiled-coil regions (%) | 0.13 |
| Predicted disordered residues (%) | 13.34 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | PF03224- PF11698 |
| Sequences matching dominant architecture (%) | 89.45 |
| Average overlap percent | 65.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D1DVI4 | 357-587 | 231 | GANSTRAGTQLIYQVVLCFWLLSFNKDIAAELNVKLGLIPLLVDVARNAVKEKVTRVTVATFRNLLAQAPGINAPVLLGSKALAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9V3J1-F1 | 203-442 | 99.57 | 92.74 | View in AlphaFoldDB ↗ |