DPCfam | MC22023
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Residues in low-complexity regions (%) | 0.47 |
| Residues in coiled-coil regions (%) | 0.76 |
| Predicted disordered residues (%) | 20.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14178 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 98.24 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M4GCN7 | 1-59 | 59 | MDISTLKTSFILQRDNDSVDANVLRDYARKLYIQNEITASTYRRLIQELEATGATVPEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P50834-F1 | 1-57 | 98.28 | 92.55 | View in AlphaFoldDB ↗ |