DPCfam | MC219921
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Residues in low-complexity regions (%) | 9.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.21 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF14774 |
| Sequences matching dominant architecture (%) | 97.8 |
| Average overlap percent | 88.83 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158QT35 | 90-187 | 98 | RVICCCDGNYYENSEQPSNVVVEEQEPEPHIGTSHQAWPQRLLAGTKVLSKKILKVTDMAGEKIAGLVGITDPKFDIYLWEHEYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QAL6-F1 | 41-141 | 98.00 | 74.04 | View in AlphaFoldDB ↗ |