DPCfam | MC219871
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Residues in low-complexity regions (%) | 5.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.24 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF11838 |
| Sequences matching dominant architecture (%) | 98.65 |
| Average overlap percent | 54.0 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009714842 | 537-709 | 173 | DLVLLNDRDLGYVKVRLDPRSQEIALRNIAKMPDPMGRVMVWTALTNSWLDGELPSKTYIDAVLAGLWGEDDDSAIRYLTNQLAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q11010-F1 | 534-704 | 98.84 | 96.52 | View in AlphaFoldDB ↗ |