DPCfam | MC21975
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Residues in low-complexity regions (%) | 2.2 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.72 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF18742 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 54.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B7K7K9 | 34-115 | 82 | LQNLELIFNKFHVIARSLKNRRDKQTPLEIKDEYDLQYLMKALLSLYFDHITEEPPIPSSAGGGSRADFWLKSEKILIETKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GXN6-F1 | 13-93 | 97.59 | 95.17 | View in AlphaFoldDB ↗ |