DPCfam | MC219277
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 111 ± 14 aa |
| Residues in low-complexity regions (%) | 2.61 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 59.59 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15936 |
| Sequences matching dominant architecture (%) | 95.24 |
| Average overlap percent | 87.19 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00074009D9 | 100-219 | 120 | SVYNSPINLYSNDTACEVAEGQRRGLKDSQGSPSQHNGGPQSILKKSPPRRAPRKPAVDTDIEFYHVPSHGDASKKRLMEDTEDW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2JYM0-F1 | 193-300 | 98.29 | 54.43 | View in AlphaFoldDB ↗ |