DPCfam | MC219239
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 951 ± 196 aa |
| Residues in low-complexity regions (%) | 3.49 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 16.62 |
| Average transmembrane regions | 0.31 |
| Dominant Pfam architecture(s) | PF14776 |
| Sequences matching dominant architecture (%) | 78.48 |
| Average overlap percent | 54.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A182R058 | 15-1136 | 1122 | TRSAAFQAKLRCLHEFHVRLLSNQVPAPTGSDVANTIKYFSQTLLTVLKDVPCSPLEMIKDPSLDQLRMSSYPNLEYQNLYNALT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0KK59-F1 | 10-1045 | 99.78 | 70.86 | View in AlphaFoldDB ↗ |