DPCfam | MC219183
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Residues in low-complexity regions (%) | 0.43 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.32 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02897 |
| Sequences matching dominant architecture (%) | 99.26 |
| Average overlap percent | 24.81 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0D6LXZ8 | 41-123 | 83 | SLKDKEKAEVFLDPNSMSVDGTTSISLLAWTEDGSTLAYGVNEKGSDWVTVRFRGANKEDIADVIERVKLSELAWLSDNSGIF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7TFH9-F1 | 154-235 | 97.62 | 94.00 | View in AlphaFoldDB ↗ |