DPCfam | MC219082
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 501 |
|---|---|
| Mean domain length (aa) | 98 ± 16 aa |
| Residues in low-complexity regions (%) | 1.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.61 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000462D183 | 27-140 | 114 | VQTIKNRYPGEPQAGKEFGYTVKDGKILIDNSIQDVDFVVDMNNNLHIERGHSFLAGGKDVQAAGTIKVNSQGYVRNITNASGHF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K7LHU0-F1 | 220-317 | 97.09 | 89.02 | View in AlphaFoldDB ↗ |