DPCfam | MC21885
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 1822 ± 264 aa |
| Residues in low-complexity regions (%) | 2.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.47 |
| Average transmembrane regions | 0.08 |
| Dominant Pfam architecture(s) | PF01833- PF10162- PF10162 |
| Sequences matching dominant architecture (%) | 21.62 |
| Average overlap percent | 60.69 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A7SHH7 | 1284-3233 | 1950 | SIVCIVPEKPAGVYPLNILIGSGGWATSSIKVTIELSIDSVNPADSGYGGGRSIVVTGKGFSDSTLITVCGTSCPLTLGFSITNT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2JZA7-F1 | 417-631 | 12.61 | 96.89 | View in AlphaFoldDB ↗ |