DPCfam | MC218617
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 431 |
|---|---|
| Mean domain length (aa) | 123 ± 19 aa |
| Residues in low-complexity regions (%) | 2.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.48 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF01480 |
| Sequences matching dominant architecture (%) | 3.31 |
| Average overlap percent | 52.92 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005D294D6 | 346-464 | 119 | YRCGIRVNGVATISNQGQPQQHDITAESFRRNPELLNRLRPWLRRELMVLYGAHGSLVDIIQRIIMARLARHGLEDTPTIEDELR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VU41-F1 | 162-311 | 99.19 | 86.97 | View in AlphaFoldDB ↗ |