DPCfam | MC218348
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 300 ± 37 aa |
| Residues in low-complexity regions (%) | 3.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.1 |
| Average transmembrane regions | 4.95 |
| Dominant Pfam architecture(s) | PF05763 |
| Sequences matching dominant architecture (%) | 98.21 |
| Average overlap percent | 40.57 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q9V0Y4 | 7-316 | 310 | EVLMGIPFLVIYVVLFYHYHISRNSSYLMYFSLAFLSLGVGIMVEDAYLAGLAFFSSFFWIGVIQFLRRLGGFKGLNLKYLLYVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0J361-F1 | 42-225 | 56.04 | 77.63 | View in AlphaFoldDB ↗ |