DPCfam | MC218029
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1491 |
|---|---|
| Mean domain length (aa) | 138 ± 15 aa |
| Residues in low-complexity regions (%) | 5.24 |
| Residues in coiled-coil regions (%) | 5.07 |
| Predicted disordered residues (%) | 32.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01814 |
| Sequences matching dominant architecture (%) | 89.58 |
| Average overlap percent | 81.81 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1S1S688 | 43-140 | 98 | HTARALARWFHGFAEEIQLHHRIEDTLLFPALAARVATYGDYAPALESDHAELDAILNQLRAALVSGDHGRSAALAEDLSDHLDR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CFA8-F1 | 95-235 | 100.00 | 96.55 | View in AlphaFoldDB ↗ |