DPCfam | MC217826
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 292 ± 42 aa |
| Residues in low-complexity regions (%) | 2.79 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.71 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00036 |
| Sequences matching dominant architecture (%) | 3.6 |
| Average overlap percent | 8.09 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q00WD6 | 475-753 | 279 | VLKCIAHIYADKLIADAAVQGHDEFASMRETSSTQPLANFVYDWHMHKFGLRQLAEANLLDLIASTVYHAAECGIVSQFGVLCGF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P25071-F1 | 183-261 | 29.93 | 73.24 | View in AlphaFoldDB ↗ |