DPCfam | MC217510
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 971 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Residues in low-complexity regions (%) | 6.91 |
| Residues in coiled-coil regions (%) | 13.16 |
| Predicted disordered residues (%) | 20.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF05235 |
| Sequences matching dominant architecture (%) | 99.59 |
| Average overlap percent | 33.55 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q6S3S4 | 88-175 | 88 | PKSNETLGDVLRTSFSATSARLLKVHPIAEIGYNTEGVHQYRVALRRMRLLLGIVRAIAPYSEAKSLSAEAKWLLNELNDARAWD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EL31-F1 | 4-87 | 97.73 | 97.69 | View in AlphaFoldDB ↗ |