DPCfam | MC217467
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 11211 |
|---|---|
| Mean domain length (aa) | 123 ± 16 aa |
| Residues in low-complexity regions (%) | 1.6 |
| Residues in coiled-coil regions (%) | 0.01 |
| Predicted disordered residues (%) | 23.89 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01464 |
| Sequences matching dominant architecture (%) | 85.75 |
| Average overlap percent | 80.68 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G9ZH20 | 511-625 | 115 | QIAREVGVEPHFVHAIISAESAYKPGAKSHAGAMGLMQLMPGTARRFGVAEPYNTGQNIRGGATYLKWLLNEFGGDMQLAAAGYN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7N7I2-F1 | 193-300 | 98.25 | 97.51 | View in AlphaFoldDB ↗ |