DPCfam | MC217408
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Residues in low-complexity regions (%) | 0.38 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF17836 |
| Sequences matching dominant architecture (%) | 34.33 |
| Average overlap percent | 87.07 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I2AYP7 | 1-79 | 78 | MKIVIYGNGKIAKVVYQFVKKKFEVVAFTVERKYKNTDFIEGVPLIEFEDIQNQCGPNEHKMLIAIGYIQMNDIREKK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P71784-F1 | 4-69 | 98.51 | 98.17 | View in AlphaFoldDB ↗ |