DPCfam | MC217348
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 52 ± 5 aa |
| Residues in low-complexity regions (%) | 1.27 |
| Residues in coiled-coil regions (%) | 0.34 |
| Predicted disordered residues (%) | 22.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03719 |
| Sequences matching dominant architecture (%) | 99.69 |
| Average overlap percent | 61.03 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2GEC2 | 112-169 | 58 | MRKFCEMLGVSDIIAKSYGSSTSGIVIRNAIKAFSLVCSPEYVAGKRNRKKSKFISKA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A4XLR3-F1 | 113-167 | 100.00 | 93.19 | View in AlphaFoldDB ↗ |