DPCfam | MC216801
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 222 ± 43 aa |
| Residues in low-complexity regions (%) | 14.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 67.63 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF15501 |
| Sequences matching dominant architecture (%) | 66.67 |
| Average overlap percent | 51.26 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7UH63 | 511-708 | 198 | KSSNSEYHRNFRPPKDYVYQDGAWGGVVPPRVEPVMEPEAEEGAPTNSWYSEVMELRKKAAEYRLRARGTHFSRSHLAQLYAQNA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5RC32-F1 | 315-558 | 99.53 | 56.23 | View in AlphaFoldDB ↗ |