DPCfam | MC216649
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 223 ± 23 aa |
| Residues in low-complexity regions (%) | 1.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03787 |
| Sequences matching dominant architecture (%) | 10.0 |
| Average overlap percent | 67.85 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0001A81452 | 1-216 | 216 | MSTLKFKCTLLTDVILNQHAATEGNQSTLDFIPGNNFLGIVAGNVYAEHRDLALDILHSGKVRFGDAHPALNGVRSLRVPSCFFY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q59063-F1 | 109-204 | 43.52 | 93.55 | View in AlphaFoldDB ↗ |