DPCfam | MC216350
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1381 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Residues in low-complexity regions (%) | 9.0 |
| Residues in coiled-coil regions (%) | 0.16 |
| Predicted disordered residues (%) | 4.12 |
| Average transmembrane regions | 1.23 |
| Dominant Pfam architecture(s) | PF06803 |
| Sequences matching dominant architecture (%) | 95.55 |
| Average overlap percent | 44.06 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009E78978 | 34-115 | 82 | FKRELKAIYLAYKSPDMPVPAKILAAIVIAYALSPIDLIPDFIPILGYLDDLILIPLGVTLVVKLVPLELMEKCRLEADAQK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B5WWL1-F1 | 18-90 | 93.67 | 71.31 | View in AlphaFoldDB ↗ |