DPCfam | MC215998
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Residues in low-complexity regions (%) | 0.6 |
| Residues in coiled-coil regions (%) | 5.72 |
| Predicted disordered residues (%) | 17.19 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03759 |
| Sequences matching dominant architecture (%) | 96.74 |
| Average overlap percent | 31.38 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A118JS19 | 415-488 | 74 | DKMELLINRAEDLSREIHIRYPNLPQKFLDVMKIQYSKDVAHAILEAYSRVLGNLAFSILTRIGDICQEDVLSD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1JKB4-F1 | 405-477 | 97.33 | 94.63 | View in AlphaFoldDB ↗ |