DPCfam | MC215997
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Residues in low-complexity regions (%) | 3.39 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.27 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13847 |
| Sequences matching dominant architecture (%) | 1.92 |
| Average overlap percent | 2.87 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A179HY41 | 272-341 | 70 | EGWTVLHVSVADQAEWDDFESRHRSGQRRWLLEHPGSEGADELRRQLDQREHDYLAHYRGILGFAFLILA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P39367-F1 | 171-245 | 96.15 | 97.90 | View in AlphaFoldDB ↗ |